| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein CD1, alpha-3 domain [88615] (5 species) |
| Domain d3u0pc2: 3u0p C:184-279 [200913] Other proteins in same PDB: d3u0pa1, d3u0pb_, d3u0pc1, d3u0pd_, d3u0pe1, d3u0pf_ automated match to d1onqa1 complexed with gol, hex, lsc, nbu, so4, und |
PDB Entry: 3u0p (more details), 2.8 Å
SCOPe Domain Sequences for d3u0pc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u0pc2 b.1.1.2 (C:184-279) CD1, alpha-3 domain {Human (Homo sapiens), CD1a [TaxId: 9606]}
qvkpkawlsrgpspgpgrlllvchvsgfypkpvwvkwmrgeqeqqgtqpgdilpnadetw
ylratldvvageaaglscrvkhsslegqdivlywhh
Timeline for d3u0pc2: