Lineage for d3u0pc2 (3u0p C:184-277)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2746777Protein CD1, alpha-3 domain [88615] (5 species)
  7. 2746782Species Human (Homo sapiens), CD1a [TaxId:9606] [101513] (5 PDB entries)
  8. 2746789Domain d3u0pc2: 3u0p C:184-277 [200913]
    Other proteins in same PDB: d3u0pa1, d3u0pa3, d3u0pb_, d3u0pc1, d3u0pc3, d3u0pd1, d3u0pd2, d3u0pe1, d3u0pf_
    automated match to d1onqa1
    complexed with gol, hex, lsc, nbu, so4, und

Details for d3u0pc2

PDB Entry: 3u0p (more details), 2.8 Å

PDB Description: crystal structure of human cd1d-lysophosphatidylcholine
PDB Compounds: (C:) Antigen-presenting glycoprotein CD1d

SCOPe Domain Sequences for d3u0pc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u0pc2 b.1.1.2 (C:184-277) CD1, alpha-3 domain {Human (Homo sapiens), CD1a [TaxId: 9606]}
qvkpkawlsrgpspgpgrlllvchvsgfypkpvwvkwmrgeqeqqgtqpgdilpnadetw
ylratldvvageaaglscrvkhsslegqdivlyw

SCOPe Domain Coordinates for d3u0pc2:

Click to download the PDB-style file with coordinates for d3u0pc2.
(The format of our PDB-style files is described here.)

Timeline for d3u0pc2: