| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
| Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species) Class I MHC-related |
| Species Human (Homo sapiens), CD1a [TaxId:9606] [102838] (15 PDB entries) |
| Domain d3u0pc1: 3u0p C:6-183 [200912] Other proteins in same PDB: d3u0pa2, d3u0pa3, d3u0pb_, d3u0pc2, d3u0pc3, d3u0pd1, d3u0pd2, d3u0pe2, d3u0pf_ automated match to d1onqa2 complexed with fuc, gol, hex, lsc, nag, nbu, so4, und |
PDB Entry: 3u0p (more details), 2.8 Å
SCOPe Domain Sequences for d3u0pc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u0pc1 d.19.1.1 (C:6-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1a [TaxId: 9606]}
rlfplrclqissfansswtrtdglawlgelqthswsqdsdtvrslkpwsqgtfsdqqwet
lqhifrvyrssftrdvkefakmlrlsyplelqvsagcevhpgqasnnffhvafqgkdils
fqgtsweptqeaplwvnlaiqvlnqdkwtretvqwllqgtcpqfvsgllesgkselkk
Timeline for d3u0pc1: