SCOPe 2.05: Domain d3u0pa1: 3u0p A:6-183

Lineage for d3u0pa1 (3u0p A:6-183)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
   Class I MHC-related

7. Species Human (Homo sapiens), CD1a [TaxId:9606] [102838] (11 PDB entries)

8. Domain d3u0pa1: 3u0p A:6-183 [200910]
   Other proteins in same PDB: d3u0pa2, d3u0pb_, d3u0pc2, d3u0pd_, d3u0pe2, d3u0pf_
   automated match to d1onqa2
   complexed with gol, hex, lsc, nbu, so4, und

Details for d3u0pa1

PDB Entry: 3u0p, 2.8 Å

PDB Description: crystal structure of human cd1d-lysophosphatidylcholine

PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d

SCOPe Domain Sequences for d3u0pa1:

Sequence; same for both SEQRES and ATOM records:

>d3u0pa1 d.19.1.1 (A:6-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1a [TaxId: 9606]}
rlfplrclqissfansswtrtdglawlgelqthswsqdsdtvrslkpwsqgtfsdqqwet
lqhifrvyrssftrdvkefakmlrlsyplelqvsagcevhpgqasnnffhvafqgkdils
fqgtsweptqeaplwvnlaiqvlnqdkwtretvqwllqgtcpqfvsgllesgkselkk

Timeline for d3u0pa1:

• d3u0pa1 first appeared in SCOPe 2.03
  
• d3u0pa1 appears in SCOPe 2.04
  
• d3u0pa1 appears in SCOPe 2.06
  
• d3u0pa1 appears in the current release, SCOPe 2.08