Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species) |
Species Fab N1G9 (mouse), lambda L chain [48811] (2 PDB entries) |
Domain d1ngph1: 1ngp H:1-120 [20091] Other proteins in same PDB: d1ngph2, d1ngpl2 |
PDB Entry: 1ngp (more details), 2.4 Å
SCOP Domain Sequences for d1ngph1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ngph1 b.1.1.1 (H:1-120) Immunoglobulin (variable domains of L and H chains) {Fab N1G9 (mouse), lambda L chain} qvqlqqpgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtky nekfkskatltvdkpsstaymqlssltsedsavyycarydyygssyfdywgqgttltvss
Timeline for d1ngph1: