Lineage for d1ngph1 (1ngp H:1-120)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52473Species Fab N1G9 (mouse), lambda L chain [48811] (2 PDB entries)
  8. 52474Domain d1ngph1: 1ngp H:1-120 [20091]
    Other proteins in same PDB: d1ngph2, d1ngpl2

Details for d1ngph1

PDB Entry: 1ngp (more details), 2.4 Å

PDB Description: n1g9 (igg1-lambda) fab fragment complexed with (4-hydroxy-3- nitrophenyl) acetate

SCOP Domain Sequences for d1ngph1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ngph1 b.1.1.1 (H:1-120) Immunoglobulin (variable domains of L and H chains) {Fab N1G9 (mouse), lambda L chain}
qvqlqqpgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtky
nekfkskatltvdkpsstaymqlssltsedsavyycarydyygssyfdywgqgttltvss

SCOP Domain Coordinates for d1ngph1:

Click to download the PDB-style file with coordinates for d1ngph1.
(The format of our PDB-style files is described here.)

Timeline for d1ngph1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ngph2