SCOP 1.55: Domain d1ngph1: 1ngp H:1-120

Lineage for d1ngph1 (1ngp H:1-120)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab N1G9 (mouse), lambda L chain [48811] (2 PDB entries)

8. Domain d1ngph1: 1ngp H:1-120 [20091]
   Other proteins in same PDB: d1ngph2, d1ngpl2

Details for d1ngph1

PDB Entry: 1ngp, 2.4 Å

PDB Description: n1g9 (igg1-lambda) fab fragment complexed with (4-hydroxy-3- nitrophenyl) acetate

SCOP Domain Sequences for d1ngph1:

Sequence; same for both SEQRES and ATOM records:

>d1ngph1 b.1.1.1 (H:1-120) Immunoglobulin (variable domains of L and H chains) {Fab N1G9 (mouse), lambda L chain}
qvqlqqpgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtky
nekfkskatltvdkpsstaymqlssltsedsavyycarydyygssyfdywgqgttltvss

Timeline for d1ngph1:

• d1ngph1 appears in SCOP 1.57
  
• d1ngph1 appears in the current release, SCOPe 2.08