SCOPe 2.05: Domain d3tzuc_: 3tzu C:

Lineage for d3tzuc_ (3tzu C:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
   sandwich of half-barrel shaped beta-sheets

4. Superfamily b.84.1: Single hybrid motif [51230] (2 families)
   7 to 8 strands in 2 beta-sheets

5. Family b.84.1.0: automated matches [191593] (1 protein)
   not a true family

6. Protein automated matches [191080] (7 species)
   not a true protein

7. Species Mycobacterium marinum [TaxId:216594] [196128] (1 PDB entry)

8. Domain d3tzuc_: 3tzu C: [200909]
   automated match to d3tzud_
   complexed with act, edo, peg

Details for d3tzuc_

PDB Entry: 3tzu, 2.3 Å

PDB Description: crystal structure of a glycine cleavage system h protein (gcvh) from mycobacterium marinum

PDB Compounds: (C:) Glycine cleavage system H protein 1

SCOPe Domain Sequences for d3tzuc_:

Sequence; same for both SEQRES and ATOM records:

>d3tzuc_ b.84.1.0 (C:) automated matches {Mycobacterium marinum [TaxId: 216594]}
ipgdrsytadhewidiapgaatpdgpvrvgitsvavealgdlvfvqlpevgetvsagesc
gevestktvsdliapasgqivevntaavddpatiatdpygagwlysvqptavgelltase
yagqngl

Timeline for d3tzuc_:

• d3tzuc_ first appeared in SCOPe 2.03
  
• d3tzuc_ appears in SCOPe 2.04
  
• d3tzuc_ appears in SCOPe 2.06
  
• d3tzuc_ appears in the current release, SCOPe 2.08