Lineage for d3tzub_ (3tzu B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1332005Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 1332006Superfamily b.84.1: Single hybrid motif [51230] (2 families) (S)
    7 to 8 strands in 2 beta-sheets
  5. 1332074Family b.84.1.0: automated matches [191593] (1 protein)
    not a true family
  6. 1332075Protein automated matches [191080] (5 species)
    not a true protein
  7. 1332081Species Mycobacterium marinum [TaxId:216594] [196128] (1 PDB entry)
  8. 1332083Domain d3tzub_: 3tzu B: [200908]
    automated match to d3tzud_
    complexed with act, edo, peg

Details for d3tzub_

PDB Entry: 3tzu (more details), 2.3 Å

PDB Description: crystal structure of a glycine cleavage system h protein (gcvh) from mycobacterium marinum
PDB Compounds: (B:) Glycine cleavage system H protein 1

SCOPe Domain Sequences for d3tzub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tzub_ b.84.1.0 (B:) automated matches {Mycobacterium marinum [TaxId: 216594]}
ipgdrsytadhewidiapgaatpdgpvrvgitsvavealgdlvfvqlpevgetvsagesc
gevestktvsdliapasgqivevntaavddpatiatdpygagwlysvqptavgelltase
yagqngl

SCOPe Domain Coordinates for d3tzub_:

Click to download the PDB-style file with coordinates for d3tzub_.
(The format of our PDB-style files is described here.)

Timeline for d3tzub_: