Lineage for d3tzqe_ (3tzq E:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1831669Species Mycobacterium marinum [TaxId:216594] [189743] (2 PDB entries)
  8. 1831676Domain d3tzqe_: 3tzq E: [200906]
    automated match to d3tzqa_
    complexed with edo, gol, peg

Details for d3tzqe_

PDB Entry: 3tzq (more details), 2.5 Å

PDB Description: crystal structure of a short-chain type dehydrogenase/reductase from mycobacterium marinum
PDB Compounds: (E:) Short-chain type dehydrogenase/reductase

SCOPe Domain Sequences for d3tzqe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tzqe_ c.2.1.0 (E:) automated matches {Mycobacterium marinum [TaxId: 216594]}
aelenkvaiitgacggigletsrvlaragarvvladlpetdlagaaasvgrgavhhvvdl
tnevsvralidftidtfgrldivdnnaahsdpadmlvtqmtvdvwddtftvnargtmlmc
kyaiprlisagggaivnissatahaaydmstayactkaaietltryvatqygrhgvrcna
iapglvrtprlevglpqpivdifathhlagrigepheiaelvcflasdraafitgqviaa
dsgllahlpglpqirasvae

SCOPe Domain Coordinates for d3tzqe_:

Click to download the PDB-style file with coordinates for d3tzqe_.
(The format of our PDB-style files is described here.)

Timeline for d3tzqe_: