![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (99 species) not a true protein |
![]() | Species Streptomyces coelicolor [TaxId:1902] [194965] (1 PDB entry) |
![]() | Domain d3tywd1: 3tyw D:17-411 [200902] Other proteins in same PDB: d3tywa2, d3tywb2, d3tywc2, d3tywd2 automated match to d3tywb_ complexed with hem |
PDB Entry: 3tyw (more details), 2.9 Å
SCOPe Domain Sequences for d3tywd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tywd1 a.104.1.0 (D:17-411) automated matches {Streptomyces coelicolor [TaxId: 1902]} pprdfpiqrgcpfaapaeyaalrtddpvarvtlptrreawvvtryddvrellsdprvsad irrpgfpalgegeqeagarfrpfirtdapehtryrrmllpaftvrrvramrpavqarvde ildgmlaaggpvdlvsayanavstsvicellgiprhdleffrdvtrisgsrnstaeqvse algglfgllgglvaerreeprddlisklvtdhlvpgnvtteqllstlgitinagrettts mialstlllldrpelpaelrkdpdlmpaavdellrvlsvadsiplrvaaedielsgrtvp addgviallaganhdpeqfddpervdfhrtdnhhvafgygvhqcvgqhlarlelevalet llrrvptlrlagerdqvvvkhdsatfgleelmvtw
Timeline for d3tywd1: