Lineage for d3tywc_ (3tyw C:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1277465Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1277466Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1278000Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 1278001Protein automated matches [190847] (33 species)
    not a true protein
  7. 1278262Species Streptomyces coelicolor [TaxId:1902] [194965] (1 PDB entry)
  8. 1278265Domain d3tywc_: 3tyw C: [200901]
    automated match to d3tywb_
    complexed with hem

Details for d3tywc_

PDB Entry: 3tyw (more details), 2.9 Å

PDB Description: crystal structure of cyp105n1 from streptomyces coelicolor a3(2)
PDB Compounds: (C:) putative cytochrome P450

SCOPe Domain Sequences for d3tywc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tywc_ a.104.1.0 (C:) automated matches {Streptomyces coelicolor [TaxId: 1902]}
pprdfpiqrgcpfaapaeyaalrtddpvarvtlptrreawvvtryddvrellsdprvsad
irrpgfpalgegeqeagarfrpfirtdapehtryrrmllpaftvrrvramrpavqarvde
ildgmlaaggpvdlvsayanavstsvicellgiprhdleffrdvtrisgsrnstaeqvse
algglfgllgglvaerreeprddlisklvtdhlvpgnvtteqllstlgitinagrettts
mialstlllldrpelpaelrkdpdlmpaavdellrvlsvadsiplrvaaedielsgrtvp
addgviallaganhdpeqfddpervdfhrtdnhhvafgygvhqcvgqhlarlelevalet
llrrvptlrlagerdqvvvkhdsatfgleelmvtwhhh

SCOPe Domain Coordinates for d3tywc_:

Click to download the PDB-style file with coordinates for d3tywc_.
(The format of our PDB-style files is described here.)

Timeline for d3tywc_: