Lineage for d1ngpl1 (1ngp L:1-109)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7793Species Fab N1G9 (mouse), lambda L chain [48811] (2 PDB entries)
  8. 7795Domain d1ngpl1: 1ngp L:1-109 [20090]
    Other proteins in same PDB: d1ngph2, d1ngpl2

Details for d1ngpl1

PDB Entry: 1ngp (more details), 2.4 Å

PDB Description: n1g9 (igg1-lambda) fab fragment complexed with (4-hydroxy-3- nitrophenyl) acetate

SCOP Domain Sequences for d1ngpl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ngpl1 b.1.1.1 (L:1-109) Immunoglobulin (variable domains of L and H chains) {Fab N1G9 (mouse), lambda L chain}
qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
parfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvl

SCOP Domain Coordinates for d1ngpl1:

Click to download the PDB-style file with coordinates for d1ngpl1.
(The format of our PDB-style files is described here.)

Timeline for d1ngpl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ngpl2