Lineage for d3tyhg_ (3tyh G:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2913797Protein Ferric-binding protein FbpA [53867] (7 species)
  7. 2913821Species Neisseria gonorrhoeae [TaxId:485] [53869] (5 PDB entries)
    Uniprot Q50964 23-331
  8. 2913846Domain d3tyhg_: 3tyh G: [200899]
    automated match to d1xc1a_
    complexed with cu

    has additional insertions and/or extensions that are not grouped together

Details for d3tyhg_

PDB Entry: 3tyh (more details), 2.1 Å

PDB Description: Crystal structure of oxo-cupper clusters binding to ferric binding protein from Neisseria gonorrhoeae
PDB Compounds: (G:) FbpA protein

SCOPe Domain Sequences for d3tyhg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tyhg_ c.94.1.1 (G:) Ferric-binding protein FbpA {Neisseria gonorrhoeae [TaxId: 485]}
ditvyngqhkeaaqavadaftratgikvklnsakgdqlagqikeegsrspadvfyseqip
alatlsaanlleplpastinetrgkgvpvaakkdwvalsgrsrvvvydtrklsekdleks
vlnyatpkwknrigyvptsgafleqivaivklkgeaaalkwlkglkeygkpyaknsvalq
avengeidaalinnyywhafarekgvqnvhtrlnfvrhrdpgalvtysgaavlkssqnkd
eakkfvaflagkegqraltavraeyplnphvvstfnlepiakleapqvsattvsekehat
rlleqagmk

SCOPe Domain Coordinates for d3tyhg_:

Click to download the PDB-style file with coordinates for d3tyhg_.
(The format of our PDB-style files is described here.)

Timeline for d3tyhg_: