Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (12 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (237 PDB entries) |
Domain d3tvmh2: 3tvm H:113-240 [200892] Other proteins in same PDB: d3tvma1, d3tvmb_, d3tvmc1, d3tvmd1, d3tvme1, d3tvmf_, d3tvmg1, d3tvmh1 automated match to d1lp9f2 complexed with 07p, cl, gol, nag |
PDB Entry: 3tvm (more details), 2.8 Å
SCOPe Domain Sequences for d3tvmh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tvmh2 b.1.1.2 (H:113-240) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dlrnvtppkvslfepskaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv saeawgra
Timeline for d3tvmh2: