Lineage for d3tvmh1 (3tvm H:1-112)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744822Domain d3tvmh1: 3tvm H:1-112 [200891]
    Other proteins in same PDB: d3tvma1, d3tvma2, d3tvmb_, d3tvmc1, d3tvmc2, d3tvmd2, d3tvme1, d3tvme2, d3tvmf_, d3tvmg1, d3tvmg2, d3tvmh2
    automated match to d1lp9f1
    complexed with 07p, cl, gol, nag

Details for d3tvmh1

PDB Entry: 3tvm (more details), 2.8 Å

PDB Description: structure of the mouse cd1d-smc124-inkt tcr complex
PDB Compounds: (H:) Vbeta8.2 (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d3tvmh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tvmh1 b.1.1.1 (H:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
eaavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdi
pdgykasrpsqenfslilelatpsqtsvyfcasgdegytqyfgpgtrllvle

SCOPe Domain Coordinates for d3tvmh1:

Click to download the PDB-style file with coordinates for d3tvmh1.
(The format of our PDB-style files is described here.)

Timeline for d3tvmh1: