| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (24 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries) |
| Domain d3tvmh1: 3tvm H:1-112 [200891] Other proteins in same PDB: d3tvma1, d3tvma2, d3tvmb_, d3tvmc1, d3tvmc2, d3tvmd2, d3tvme1, d3tvme2, d3tvmf_, d3tvmg1, d3tvmg2, d3tvmh2 automated match to d1lp9f1 complexed with 07p, cl, gol, nag |
PDB Entry: 3tvm (more details), 2.8 Å
SCOPe Domain Sequences for d3tvmh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tvmh1 b.1.1.1 (H:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
eaavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdi
pdgykasrpsqenfslilelatpsqtsvyfcasgdegytqyfgpgtrllvle
Timeline for d3tvmh1: