Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (23 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries) |
Domain d3tvmg1: 3tvm G:1-117 [200889] Other proteins in same PDB: d3tvma1, d3tvma2, d3tvmb_, d3tvmc2, d3tvmd1, d3tvmd2, d3tvme1, d3tvme2, d3tvmf_, d3tvmg2, d3tvmh1, d3tvmh2 automated match to d1qrnd1 complexed with 07p, cl, gol, nag |
PDB Entry: 3tvm (more details), 2.8 Å
SCOPe Domain Sequences for d3tvmg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tvmg1 b.1.1.0 (G:1-117) automated matches {Mouse (Mus musculus) [TaxId: 10090]} tqveqspqslvvrqgencvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsngr ysatldkdakhstlhitatllddtatyicvvgdrgsalgrlhfgagtqlivipd
Timeline for d3tvmg1: