SCOPe 2.08: Domain d3tvme2: 3tvm E:186-249

Lineage for d3tvme2 (3tvm E:186-249)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d3tvme2: 3tvm E:186-249 [200888]
   Other proteins in same PDB: d3tvma1, d3tvmb_, d3tvmc1, d3tvmd1, d3tvme1, d3tvmf_, d3tvmg1, d3tvmh1
   automated match to d1onqa1
   complexed with 07p, cl, gol, nag
   fragment; missing more than one-third of the common structure and/or sequence

Details for d3tvme2

PDB Entry: 3tvm, 2.8 Å

PDB Description: structure of the mouse cd1d-smc124-inkt tcr complex

PDB Compounds: (E:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d3tvme2:

Sequence, based on SEQRES records:

>d3tvme2 b.1.1.2 (E:186-249) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqa

Sequence, based on observed residues (ATOM records):

>d3tvme2 b.1.1.2 (E:186-249) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qewlssvplvchvsgfypkpvflpnadetwylqa

Timeline for d3tvme2:

• d3tvme2 first appeared in SCOPe 2.03
  
• d3tvme2 appears in SCOPe 2.07