Lineage for d3tvmd2 (3tvm D:113-240)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2030580Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries)
  8. 2030985Domain d3tvmd2: 3tvm D:113-240 [200886]
    Other proteins in same PDB: d3tvma1, d3tvmb_, d3tvmc1, d3tvmd1, d3tvme1, d3tvmf_, d3tvmg1, d3tvmh1
    automated match to d1lp9f2
    complexed with 07p, cl, gol, nag

Details for d3tvmd2

PDB Entry: 3tvm (more details), 2.8 Å

PDB Description: structure of the mouse cd1d-smc124-inkt tcr complex
PDB Compounds: (D:) Vbeta8.2 (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d3tvmd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tvmd2 b.1.1.2 (D:113-240) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlrnvtppkvslfepskaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

SCOPe Domain Coordinates for d3tvmd2:

Click to download the PDB-style file with coordinates for d3tvmd2.
(The format of our PDB-style files is described here.)

Timeline for d3tvmd2: