Lineage for d3tvmc1 (3tvm C:1-117)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1296776Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries)
  8. 1297103Domain d3tvmc1: 3tvm C:1-117 [200883]
    Other proteins in same PDB: d3tvma1, d3tvma2, d3tvmb_, d3tvmc2, d3tvmd1, d3tvmd2, d3tvme1, d3tvme2, d3tvmf_, d3tvmg2, d3tvmh1, d3tvmh2
    automated match to d1qrnd1
    complexed with 07p, cl, gol, nag

Details for d3tvmc1

PDB Entry: 3tvm (more details), 2.8 Å

PDB Description: structure of the mouse cd1d-smc124-inkt tcr complex
PDB Compounds: (C:) Valpha14 (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d3tvmc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tvmc1 b.1.1.0 (C:1-117) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tqveqspqslvvrqgencvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsngr
ysatldkdakhstlhitatllddtatyicvvgdrgsalgrlhfgagtqlivipd

SCOPe Domain Coordinates for d3tvmc1:

Click to download the PDB-style file with coordinates for d3tvmc1.
(The format of our PDB-style files is described here.)

Timeline for d3tvmc1: