SCOPe 2.08: Domain d3tvmc1: 3tvm C:1-117

Lineage for d3tvmc1 (3tvm C:1-117)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d3tvmc1: 3tvm C:1-117 [200883]
   Other proteins in same PDB: d3tvma1, d3tvma2, d3tvmb_, d3tvmc2, d3tvmd1, d3tvmd2, d3tvme1, d3tvme2, d3tvmf_, d3tvmg2, d3tvmh1, d3tvmh2
   automated match to d1qrnd1
   complexed with 07p, cl, gol, nag

Details for d3tvmc1

PDB Entry: 3tvm, 2.8 Å

PDB Description: structure of the mouse cd1d-smc124-inkt tcr complex

PDB Compounds: (C:) Valpha14 (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d3tvmc1:

Sequence; same for both SEQRES and ATOM records:

>d3tvmc1 b.1.1.0 (C:1-117) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tqveqspqslvvrqgencvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsngr
ysatldkdakhstlhitatllddtatyicvvgdrgsalgrlhfgagtqlivipd

Timeline for d3tvmc1:

• d3tvmc1 first appeared in SCOPe 2.03
  
• d3tvmc1 appears in SCOPe 2.07