Lineage for d3tvma2 (3tvm A:186-279)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752874Domain d3tvma2: 3tvm A:186-279 [200882]
    Other proteins in same PDB: d3tvma1, d3tvmb_, d3tvmc1, d3tvmd1, d3tvme1, d3tvmf_, d3tvmg1, d3tvmh1
    automated match to d1onqa1
    complexed with 07p, cl, gol, nag

Details for d3tvma2

PDB Entry: 3tvm (more details), 2.8 Å

PDB Description: structure of the mouse cd1d-smc124-inkt tcr complex
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d3tvma2:

Sequence, based on SEQRES records: (download)

>d3tvma2 b.1.1.2 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

Sequence, based on observed residues (ATOM records): (download)

>d3tvma2 b.1.1.2 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpsshrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylq
atldgeeaglacrvkhsslggqdiilyw

SCOPe Domain Coordinates for d3tvma2:

Click to download the PDB-style file with coordinates for d3tvma2.
(The format of our PDB-style files is described here.)

Timeline for d3tvma2: