![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
![]() | Protein automated matches [226842] (4 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [224924] (31 PDB entries) |
![]() | Domain d3tvma1: 3tvm A:6-185 [200881] Other proteins in same PDB: d3tvma2, d3tvmb_, d3tvmc1, d3tvmc2, d3tvmd1, d3tvmd2, d3tvme2, d3tvmf_, d3tvmg1, d3tvmg2, d3tvmh1, d3tvmh2 automated match to d1onqa2 complexed with 07p, cl, gol, nag |
PDB Entry: 3tvm (more details), 2.8 Å
SCOPe Domain Sequences for d3tvma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tvma1 d.19.1.0 (A:6-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]} knytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwek lqhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyv vrfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek
Timeline for d3tvma1: