![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins) has additional insertions and/or extensions that are not grouped together |
![]() | Protein automated matches [190140] (37 species) not a true protein |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [195694] (3 PDB entries) |
![]() | Domain d3ttka_: 3ttk A: [200879] automated match to d3ttkc_ |
PDB Entry: 3ttk (more details), 2.97 Å
SCOPe Domain Sequences for d3ttka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ttka_ c.94.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} dnkvlhvynwsdyiapdtlekftketgikvvydvydsnevleakllagksgydvvvpsns flakqikagvyqkldksklpnwknlnkdlmhtlevsdpgnehaipymwgtigigynpdkv kaafgdnapvdswdlvfkpeniqklkqcgvsfldspteilpaalhylgykpdtdnpkelk aaeelflkirpyvtyfhsskyisdlangnicvaigysgdiyqaksraeeaknkvtvkyni pkegagsffdmvaipkdaentegalafvnflmkpeimaeitdvvqfpngnaaatplvsea irndpgiypseevmkklytfpdlpaktqramtrswtkiks
Timeline for d3ttka_: