Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies) 2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies |
Superfamily c.10.1: RNI-like [52047] (4 families) regular structure consisting of similar repeats |
Family c.10.1.1: 28-residue LRR [52048] (3 proteins) this is a repeat family; one repeat unit is 1a4y A:207-235 found in domain |
Protein automated matches [190173] (3 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [193512] (1 PDB entry) |
Domain d3tsrf1: 3tsr F:1-456 [200877] Other proteins in same PDB: d3tsra_, d3tsrb_, d3tsrc_, d3tsrd_, d3tsre2, d3tsrf2, d3tsrg2, d3tsrh2 automated match to d3tsrg_ complexed with edo, peg |
PDB Entry: 3tsr (more details), 2.2 Å
SCOPe Domain Sequences for d3tsrf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tsrf1 c.10.1.1 (F:1-456) automated matches {Mouse (Mus musculus) [TaxId: 10090]} msldiqceqlsdarwtellpliqqyevvrlddcgltevrckdissavqanpaltelslrt nelgdggvglvlqglqnptckiqklslqncglteagcgilpgmlrslstlrelhlndnpm gdaglkllceglqdpqcrleklqleycnltatsceplasvlrvkadfkelvlsnndlhep gvrilcqglkdsacqleslklencgitaanckdlcdvvaskaslqeldlssnklgnagia alcpglllpscklrtlwlwecditaegckdlcrvlrakqslkelslasnelkdegarllc esllepgcqleslwiktcsltaascpyfcsvltksrsllelqmssnplgdegvqelckal sqpdtvlrelwlgdcdvtnsgcsslanvllanrslreldlsnncmggpgvlqlleslkqp sctlqqlvlydiywtneveeqlraleeerpslriis
Timeline for d3tsrf1: