SCOPe 2.06: Domain d3tsrf1: 3tsr F:1-456

Lineage for d3tsrf1 (3tsr F:1-456)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.10: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) [52046] (3 superfamilies)
   2 curved layers, a/b; parallel beta-sheet; order 1234...N; there are sequence similarities between different superfamilies

4. Superfamily c.10.1: RNI-like [52047] (4 families)
   regular structure consisting of similar repeats

5. Family c.10.1.1: 28-residue LRR [52048] (3 proteins)
   this is a repeat family; one repeat unit is 1a4y A:207-235 found in domain

6. Protein automated matches [190173] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [193512] (1 PDB entry)

8. Domain d3tsrf1: 3tsr F:1-456 [200877]
   Other proteins in same PDB: d3tsra_, d3tsrb_, d3tsrc_, d3tsrd_, d3tsre2, d3tsrf2, d3tsrg2, d3tsrh2
   automated match to d3tsrg_
   complexed with edo, peg

Details for d3tsrf1

PDB Entry: 3tsr, 2.2 Å

PDB Description: x-ray structure of mouse ribonuclease inhibitor complexed with mouse ribonuclease 1

PDB Compounds: (F:) ribonuclease inhibitor

SCOPe Domain Sequences for d3tsrf1:

Sequence; same for both SEQRES and ATOM records:

>d3tsrf1 c.10.1.1 (F:1-456) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
msldiqceqlsdarwtellpliqqyevvrlddcgltevrckdissavqanpaltelslrt
nelgdggvglvlqglqnptckiqklslqncglteagcgilpgmlrslstlrelhlndnpm
gdaglkllceglqdpqcrleklqleycnltatsceplasvlrvkadfkelvlsnndlhep
gvrilcqglkdsacqleslklencgitaanckdlcdvvaskaslqeldlssnklgnagia
alcpglllpscklrtlwlwecditaegckdlcrvlrakqslkelslasnelkdegarllc
esllepgcqleslwiktcsltaascpyfcsvltksrsllelqmssnplgdegvqelckal
sqpdtvlrelwlgdcdvtnsgcsslanvllanrslreldlsnncmggpgvlqlleslkqp
sctlqqlvlydiywtneveeqlraleeerpslriis

Timeline for d3tsrf1:

• d3tsrf1 first appeared in SCOPe 2.03, called d3tsrf_
  
• d3tsrf1 was called d3tsrf_ in SCOPe 2.05
  
• d3tsrf1 appears in SCOPe 2.07
  
• d3tsrf1 appears in the current release, SCOPe 2.08