Lineage for d2rcsh1 (2rcs H:1-114)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7427Species Fab 48G7 (mouse/human), kappa L chain [48810] (4 PDB entries)
  8. 7432Domain d2rcsh1: 2rcs H:1-114 [20087]
    Other proteins in same PDB: d2rcsh2, d2rcsl2

Details for d2rcsh1

PDB Entry: 2rcs (more details), 2.1 Å

PDB Description: immunoglobulin 48g7 germline fab-affinity maturation of an esterolytic antibody

SCOP Domain Sequences for d2rcsh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rcsh1 b.1.1.1 (H:1-114) Immunoglobulin (variable domains of L and H chains) {Fab 48G7 (mouse/human), kappa L chain}
qvqlqqsgaelvkpgasvklsctasgfnikdtymhwvkqrpeqglewigridpangntky
dpkfqgkatitadtssntaylqlssltsedtavyycasyygiywgqgttltvssa

SCOP Domain Coordinates for d2rcsh1:

Click to download the PDB-style file with coordinates for d2rcsh1.
(The format of our PDB-style files is described here.)

Timeline for d2rcsh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2rcsh2