Lineage for d3trrb_ (3trr B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1835239Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 1835240Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 1836183Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 1836184Protein automated matches [190246] (49 species)
    not a true protein
  7. 1836425Species Mycobacterium abscessus [TaxId:561007] [189671] (6 PDB entries)
  8. 1836436Domain d3trrb_: 3trr B: [200868]
    automated match to d3trrf_
    complexed with edo, gol, peg

Details for d3trrb_

PDB Entry: 3trr (more details), 2.09 Å

PDB Description: crystal structure of a probable enoyl-coa hydratase/isomerase from mycobacterium abscessus
PDB Compounds: (B:) Probable enoyl-CoA hydratase/isomerase

SCOPe Domain Sequences for d3trrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3trrb_ c.14.1.0 (B:) automated matches {Mycobacterium abscessus [TaxId: 561007]}
adevlieqrdrvllitinrpdarnavnravsqglaaaadqldssadlsvaiitgaggnfc
agmdlkafvsgeavlserglgftnvpprkpiiaavegfalaggtelvlscdlvvagrsak
fgipevkrglvagaggllrlpnripyqvamelaltgesftaedaakygfinrlvddgqal
dtalelaakitangplavaatkriiiesaswapeeafakqgeilmpifvsedakegakaf
aekrapvwqgk

SCOPe Domain Coordinates for d3trrb_:

Click to download the PDB-style file with coordinates for d3trrb_.
(The format of our PDB-style files is described here.)

Timeline for d3trrb_: