Lineage for d3trjb_ (3trj B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140243Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2140244Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2140444Family c.80.1.0: automated matches [191405] (1 protein)
    not a true family
  6. 2140445Protein automated matches [190547] (14 species)
    not a true protein
  7. 2140491Species Francisella tularensis [TaxId:119856] [193630] (1 PDB entry)
  8. 2140493Domain d3trjb_: 3trj B: [200865]
    automated match to d3trjd_

Details for d3trjb_

PDB Entry: 3trj (more details), 2.8 Å

PDB Description: structure of a phosphoheptose isomerase from francisella tularensis
PDB Compounds: (B:) Phosphoheptose isomerase

SCOPe Domain Sequences for d3trjb_:

Sequence, based on SEQRES records: (download)

>d3trjb_ c.80.1.0 (B:) automated matches {Francisella tularensis [TaxId: 119856]}
mtsldkinsyfessiqakietanalppaiaqaakamvsclenggkvlvcgngssgviaqh
ftskllnhfemerpplpaialtgdvatitavgnhygfsqifakqvaalgneddillvitt
sgdsenilsaveeahdlemkvialtggsggalqnmyntddielrvpsdnianiqenhfli
vhclcdiidqk

Sequence, based on observed residues (ATOM records): (download)

>d3trjb_ c.80.1.0 (B:) automated matches {Francisella tularensis [TaxId: 119856]}
mtsldkinsyfessiqakietanalppaiaqaakamvsclenggkvlvcgngssgviaqh
ftskllnplpaialtgdvatitavgnhygfsqifakqvaalgneddillvittsgdseni
lsaveeahdlemkvialtggsggalqnmyntddielrvpsdnianiqenhflivhclcdi
idqk

SCOPe Domain Coordinates for d3trjb_:

Click to download the PDB-style file with coordinates for d3trjb_.
(The format of our PDB-style files is described here.)

Timeline for d3trjb_: