SCOPe 2.04: Domain d3tr8a_: 3tr8 A:

Lineage for d3tr8a_ (3tr8 A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins)
   contains Pfam PF00929

6. Protein automated matches [190162] (4 species)
   not a true protein

7. Species Coxiella burnetii [TaxId:777] [196134] (1 PDB entry)

8. Domain d3tr8a_: 3tr8 A: [200862]
   automated match to d3tr8b_
   complexed with act, mg, mn

Details for d3tr8a_

PDB Entry: 3tr8, 2.5 Å

PDB Description: structure of an oligoribonuclease (orn) from coxiella burnetii

PDB Compounds: (A:) Oligoribonuclease

SCOPe Domain Sequences for d3tr8a_:

Sequence; same for both SEQRES and ATOM records:

>d3tr8a_ c.55.3.5 (A:) automated matches {Coxiella burnetii [TaxId: 777]}
snamdfsddnliwldlemtgldperdriieiativtnshldilaegpafaihqpdkllta
mdnwntshhtasgllervknssvdeveaetltlaflekyvsagksplcgnsvcqdrrfls
rymprlnqffhyrhldvttlkilaqrwapqiaaahikesqhlalqdirdsieelryyrah
llnl

Timeline for d3tr8a_:

• d3tr8a_ first appeared in SCOPe 2.03
  
• d3tr8a_ appears in SCOPe 2.05
  
• d3tr8a_ appears in the current release, SCOPe 2.08, called d3tr8a1