Lineage for d3tr8a_ (3tr8 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1373755Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 1374321Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins)
    contains Pfam PF00929
  6. 1374624Protein automated matches [190162] (4 species)
    not a true protein
  7. 1374625Species Coxiella burnetii [TaxId:777] [196134] (1 PDB entry)
  8. 1374626Domain d3tr8a_: 3tr8 A: [200862]
    automated match to d3tr8b_
    complexed with act, mg, mn

Details for d3tr8a_

PDB Entry: 3tr8 (more details), 2.5 Å

PDB Description: structure of an oligoribonuclease (orn) from coxiella burnetii
PDB Compounds: (A:) Oligoribonuclease

SCOPe Domain Sequences for d3tr8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tr8a_ c.55.3.5 (A:) automated matches {Coxiella burnetii [TaxId: 777]}
snamdfsddnliwldlemtgldperdriieiativtnshldilaegpafaihqpdkllta
mdnwntshhtasgllervknssvdeveaetltlaflekyvsagksplcgnsvcqdrrfls
rymprlnqffhyrhldvttlkilaqrwapqiaaahikesqhlalqdirdsieelryyrah
llnl

SCOPe Domain Coordinates for d3tr8a_:

Click to download the PDB-style file with coordinates for d3tr8a_.
(The format of our PDB-style files is described here.)

Timeline for d3tr8a_: