Lineage for d3tr8a1 (3tr8 A:1-181)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2886484Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
    contains Pfam PF00929
  6. 2886872Protein automated matches [190162] (6 species)
    not a true protein
  7. 2886879Species Coxiella burnetii [TaxId:777] [196134] (1 PDB entry)
  8. 2886880Domain d3tr8a1: 3tr8 A:1-181 [200862]
    Other proteins in same PDB: d3tr8a2, d3tr8b2
    automated match to d3tr8b_
    complexed with act, mg, mn

Details for d3tr8a1

PDB Entry: 3tr8 (more details), 2.5 Å

PDB Description: structure of an oligoribonuclease (orn) from coxiella burnetii
PDB Compounds: (A:) Oligoribonuclease

SCOPe Domain Sequences for d3tr8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tr8a1 c.55.3.5 (A:1-181) automated matches {Coxiella burnetii [TaxId: 777]}
mdfsddnliwldlemtgldperdriieiativtnshldilaegpafaihqpdklltamdn
wntshhtasgllervknssvdeveaetltlaflekyvsagksplcgnsvcqdrrflsrym
prlnqffhyrhldvttlkilaqrwapqiaaahikesqhlalqdirdsieelryyrahlln
l

SCOPe Domain Coordinates for d3tr8a1:

Click to download the PDB-style file with coordinates for d3tr8a1.
(The format of our PDB-style files is described here.)

Timeline for d3tr8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tr8a2