![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins) contains Pfam PF00929 |
![]() | Protein automated matches [190162] (6 species) not a true protein |
![]() | Species Coxiella burnetii [TaxId:777] [196134] (1 PDB entry) |
![]() | Domain d3tr8a1: 3tr8 A:1-181 [200862] Other proteins in same PDB: d3tr8a2, d3tr8b2 automated match to d3tr8b_ complexed with act, mg, mn |
PDB Entry: 3tr8 (more details), 2.5 Å
SCOPe Domain Sequences for d3tr8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tr8a1 c.55.3.5 (A:1-181) automated matches {Coxiella burnetii [TaxId: 777]} mdfsddnliwldlemtgldperdriieiativtnshldilaegpafaihqpdklltamdn wntshhtasgllervknssvdeveaetltlaflekyvsagksplcgnsvcqdrrflsrym prlnqffhyrhldvttlkilaqrwapqiaaahikesqhlalqdirdsieelryyrahlln l
Timeline for d3tr8a1: