SCOPe 2.07: Domain d3tr8a1: 3tr8 A:1-181

Lineage for d3tr8a1 (3tr8 A:1-181)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 protein domains)
   contains Pfam PF00929

6. Protein automated matches [190162] (5 species)
   not a true protein

7. Species Coxiella burnetii [TaxId:777] [196134] (1 PDB entry)

8. Domain d3tr8a1: 3tr8 A:1-181 [200862]
   Other proteins in same PDB: d3tr8a2, d3tr8b2
   automated match to d3tr8b_
   complexed with act, mg, mn

Details for d3tr8a1

PDB Entry: 3tr8, 2.5 Å

PDB Description: structure of an oligoribonuclease (orn) from coxiella burnetii

PDB Compounds: (A:) Oligoribonuclease

SCOPe Domain Sequences for d3tr8a1:

Sequence; same for both SEQRES and ATOM records:

>d3tr8a1 c.55.3.5 (A:1-181) automated matches {Coxiella burnetii [TaxId: 777]}
mdfsddnliwldlemtgldperdriieiativtnshldilaegpafaihqpdklltamdn
wntshhtasgllervknssvdeveaetltlaflekyvsagksplcgnsvcqdrrflsrym
prlnqffhyrhldvttlkilaqrwapqiaaahikesqhlalqdirdsieelryyrahlln
l

Timeline for d3tr8a1:

• d3tr8a1 first appeared in SCOPe 2.03, called d3tr8a_
  
• d3tr8a1 appears in SCOPe 2.06