Lineage for d3tr2a_ (3tr2 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079793Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2079794Protein automated matches [190292] (34 species)
    not a true protein
  7. 2079843Species Coxiella burnetii [TaxId:777] [196137] (1 PDB entry)
  8. 2079844Domain d3tr2a_: 3tr2 A: [200861]
    automated match to d3tr2b_

Details for d3tr2a_

PDB Entry: 3tr2 (more details), 2 Å

PDB Description: structure of a orotidine 5'-phosphate decarboxylase (pyrf) from coxiella burnetii
PDB Compounds: (A:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d3tr2a_:

Sequence, based on SEQRES records: (download)

>d3tr2a_ c.1.2.0 (A:) automated matches {Coxiella burnetii [TaxId: 777]}
dpkvivaidagtveqaraqinpltpelchlkigsilftrygpafveelmqkgyrifldlk
fydipqtvagacravaelgvwmmnihisggrtmmetvvnalqsitlkekplligvtilts
ldgsdlktlgiqekvpdivcrmatlaksagldgvvcsaqeaallrkqfdrnfllvtpgir
letdekgdqkrvmtpraaiqagsdylvigrpitqstdplkaleaidkdi

Sequence, based on observed residues (ATOM records): (download)

>d3tr2a_ c.1.2.0 (A:) automated matches {Coxiella burnetii [TaxId: 777]}
dpkvivaidagtveqaraqinpltpelchlkigsilftrygpafveelmqkgyrifldlk
fydipqtvagacravaelgvwmmnihisggrtmmetvvnalqsitlkekplligvtilts
ldgsdlktlgiqekvpdivcrmatlaksagldgvvcsaqeaallrkqfdrnfllvtpgir
rvmtpraaiqagsdylvigrpitqstdplkaleaidkdi

SCOPe Domain Coordinates for d3tr2a_:

Click to download the PDB-style file with coordinates for d3tr2a_.
(The format of our PDB-style files is described here.)

Timeline for d3tr2a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3tr2b_