Lineage for d2rcsl1 (2rcs L:1-109)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652980Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 653521Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (181 PDB entries)
  8. 653601Domain d2rcsl1: 2rcs L:1-109 [20086]
    Other proteins in same PDB: d2rcsh1, d2rcsh2, d2rcsl2
    part of humanized Fab 48G7

Details for d2rcsl1

PDB Entry: 2rcs (more details), 2.1 Å

PDB Description: immunoglobulin 48g7 germline fab-affinity maturation of an esterolytic antibody
PDB Compounds: (L:) immunoglobulin 48g7 germline fab

SCOP Domain Sequences for d2rcsl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rcsl1 b.1.1.1 (L:1-109) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
diqmtqspsslsaslgervsltcrasqeisgylswlqqkpdgtikrliyaastldsgvpk
rfsgsrsgsdysltisslesedfadyyclqyasyprtfgggtkveikrt

SCOP Domain Coordinates for d2rcsl1:

Click to download the PDB-style file with coordinates for d2rcsl1.
(The format of our PDB-style files is described here.)

Timeline for d2rcsl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2rcsl2