![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.91: PEP carboxykinase-like [53794] (1 superfamily) contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side |
![]() | Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families) ![]() |
![]() | Family c.91.1.0: automated matches [196141] (1 protein) not a true family |
![]() | Protein automated matches [196142] (6 species) not a true protein |
![]() | Species Coxiella burnetii [TaxId:777] [196143] (1 PDB entry) |
![]() | Domain d3tqfa_: 3tqf A: [200859] automated match to d3tqfb_ complexed with po4 |
PDB Entry: 3tqf (more details), 2.8 Å
SCOPe Domain Sequences for d3tqfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tqfa_ c.91.1.0 (A:) automated matches {Coxiella burnetii [TaxId: 777]} kqtwhanflvidkmgvlitgeanigkselslalidrghqlvcddvidlkqennqligscp svangyilitgigiidvpklfgldavvnqhevhlsislvkpekmpllddplnplyrteii lginvpkilfpihpgrnlpllietlvrnhrlkmegydsshhfheh
Timeline for d3tqfa_: