SCOPe 2.08: Domain d3tqfa_: 3tqf A:

Lineage for d3tqfa_ (3tqf A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
   contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side

4. Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families)

5. Family c.91.1.0: automated matches [196141] (1 protein)
   not a true family

6. Protein automated matches [196142] (6 species)
   not a true protein

7. Species Coxiella burnetii [TaxId:777] [196143] (1 PDB entry)

8. Domain d3tqfa_: 3tqf A: [200859]
   automated match to d3tqfb_
   complexed with po4

Details for d3tqfa_

PDB Entry: 3tqf, 2.8 Å

PDB Description: structure of the hpr(ser) kinase/phosphatase from coxiella burnetii

PDB Compounds: (A:) Hpr(Ser) kinase

SCOPe Domain Sequences for d3tqfa_:

Sequence; same for both SEQRES and ATOM records:

>d3tqfa_ c.91.1.0 (A:) automated matches {Coxiella burnetii [TaxId: 777]}
kqtwhanflvidkmgvlitgeanigkselslalidrghqlvcddvidlkqennqligscp
svangyilitgigiidvpklfgldavvnqhevhlsislvkpekmpllddplnplyrteii
lginvpkilfpihpgrnlpllietlvrnhrlkmegydsshhfheh

Timeline for d3tqfa_:

• d3tqfa_ first appeared in SCOPe 2.03
  
• d3tqfa_ appears in SCOPe 2.07