Lineage for d3tqca_ (3tqc A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114056Species Coxiella burnetii [TaxId:777] [196130] (3 PDB entries)
  8. 2114058Domain d3tqca_: 3tqc A: [200858]
    automated match to d3tqcb_
    complexed with adp

Details for d3tqca_

PDB Entry: 3tqc (more details), 2.3 Å

PDB Description: structure of the pantothenate kinase (coaa) from coxiella burnetii
PDB Compounds: (A:) pantothenate kinase

SCOPe Domain Sequences for d3tqca_:

Sequence, based on SEQRES records: (download)

>d3tqca_ c.37.1.0 (A:) automated matches {Coxiella burnetii [TaxId: 777]}
itpylqfnrqqwgnfrkdtpltltesdldklqgqieivslkevteiylplsrllsfyvta
rqtlqqatyqflgkpepkvpyiigiagsvavgksttsrvlkallsrwpdhpnvevittdg
flysnaklekqglmkrkgfpesydmpsllrvlnaiksgqrnvripvyshhyydivrgqye
ivdqpdivileglnilqtgvrktlqqlqvfvsdffdfslfvdaqaqviqkwyidrvlsfw
rttfkdphsyfhyltqmsetevaafakhvwneinkvnlmenilpyknraqlilekaadhs
iqkvylrki

Sequence, based on observed residues (ATOM records): (download)

>d3tqca_ c.37.1.0 (A:) automated matches {Coxiella burnetii [TaxId: 777]}
itpylqfnrqqwgnltltesdldklqgqieivslkevteiylplsrllsfyvtarqtlqq
atyqflgkpepkvpyiigiagsvavgksttsrvlkallsrwpdhpnvevittdgflysna
klekqglmkrkgfpesydmpsllrvlnaiksgqrnvripvyshhyydivrgqyeivdqpd
ivileglnilqtgvrktlqqlqvfvsdffdfslfvdaqaqviqkwyidrvlsfwrttfkd
phsyfhyltqmsetevaafakhvwneinkvnlmenilpyknraqlilekaadhsiqkvyl
rki

SCOPe Domain Coordinates for d3tqca_:

Click to download the PDB-style file with coordinates for d3tqca_.
(The format of our PDB-style files is described here.)

Timeline for d3tqca_: