Class b: All beta proteins [48724] (177 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.10: Cap-Gly domain [74924] (2 families) |
Family b.34.10.1: Cap-Gly domain [74925] (11 proteins) Pfam PF01302 |
Protein Dynactin 1 [141234] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141235] (9 PDB entries) Uniprot Q14203 1-99! Uniprot Q14203 25-98 |
Domain d3tq7q_: 3tq7 Q: [200857] Other proteins in same PDB: d3tq7a_, d3tq7b_ automated match to d1txqa1 |
PDB Entry: 3tq7 (more details), 2.3 Å
SCOPe Domain Sequences for d3tq7q_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tq7q_ b.34.10.1 (Q:) Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]} lrvgsrvevigkghrgtvayvgmtlfatgkwvgvildeakgkndgtvqgrkyftcdeghg ifvrqsqiqvf
Timeline for d3tq7q_: