Lineage for d3tq7q_ (3tq7 Q:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2055409Superfamily b.34.10: Cap-Gly domain [74924] (2 families) (S)
  5. 2055410Family b.34.10.1: Cap-Gly domain [74925] (11 proteins)
    Pfam PF01302
  6. 2055435Protein Dynactin 1 [141234] (1 species)
  7. 2055436Species Human (Homo sapiens) [TaxId:9606] [141235] (9 PDB entries)
    Uniprot Q14203 1-99! Uniprot Q14203 25-98
  8. 2055448Domain d3tq7q_: 3tq7 Q: [200857]
    Other proteins in same PDB: d3tq7a_, d3tq7b_
    automated match to d1txqa1

Details for d3tq7q_

PDB Entry: 3tq7 (more details), 2.3 Å

PDB Description: EB1c/EB3c heterodimer in complex with the CAP-Gly domain of P150glued
PDB Compounds: (Q:) Dynactin subunit 1

SCOPe Domain Sequences for d3tq7q_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tq7q_ b.34.10.1 (Q:) Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]}
lrvgsrvevigkghrgtvayvgmtlfatgkwvgvildeakgkndgtvqgrkyftcdeghg
ifvrqsqiqvf

SCOPe Domain Coordinates for d3tq7q_:

Click to download the PDB-style file with coordinates for d3tq7q_.
(The format of our PDB-style files is described here.)

Timeline for d3tq7q_: