Lineage for d3tmlc1 (3tml C:1-283)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086456Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2086457Protein automated matches [190115] (75 species)
    not a true protein
  7. 2086572Species Burkholderia cenocepacia [TaxId:216591] [196152] (1 PDB entry)
  8. 2086575Domain d3tmlc1: 3tml C:1-283 [200845]
    Other proteins in same PDB: d3tmla2, d3tmlb2, d3tmlc2, d3tmld2
    automated match to d3tmld_
    complexed with cl, so4

Details for d3tmlc1

PDB Entry: 3tml (more details), 1.9 Å

PDB Description: Crystal structure of 2-dehydro-3-deoxyphosphooctonate aldolase from Burkholderia cenocepacia
PDB Compounds: (C:) 2-dehydro-3-deoxyphosphooctonate aldolase

SCOPe Domain Sequences for d3tmlc1:

Sequence, based on SEQRES records: (download)

>d3tmlc1 c.1.10.0 (C:1-283) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
mklcdfevgldqpffliagtcvveseqmtidtagrlkeiceklnvpfiykssydkanrss
gksfrglgmdeglrilsevkrqlglpvltdvhsideieqvasvvdvlqtpaflcrqtdfi
hacarsgkpvnikkgqflaphdmknvidkardaareaglsedrfmacergvsfgynnlvs
dmrslaimretnapvvfdathsvqlpggqgtssggqrefvpvlaraavatgvaglfmeth
pnpaeaksdgpnavplnrmgalletlvtldqavkrnpflendf

Sequence, based on observed residues (ATOM records): (download)

>d3tmlc1 c.1.10.0 (C:1-283) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
mklcdfevgldqpffliagtcvveseqmtidtagrlkeiceklnvpfiykssylgmdegl
rilsevkrqlglpvltdvhsideieqvasvvdvlqtpaflcrqtdfihacarsgkpvnik
kgqflaphdmknvidkardaareaglsedrfmacergvsfgynnlvsdmrslaimretna
pvvfdathsvqlpggqrefvpvlaraavatgvaglfmethpnpaeaksdgpnavplnrmg
alletlvtldqavkrnpflendf

SCOPe Domain Coordinates for d3tmlc1:

Click to download the PDB-style file with coordinates for d3tmlc1.
(The format of our PDB-style files is described here.)

Timeline for d3tmlc1: