Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (6 species) |
Species Human (Homo sapiens) [TaxId:9606] [88602] (424 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
Domain d3tm6e1: 3tm6 E:1-97 [200839] Other proteins in same PDB: d3tm6a2, d3tm6b2, d3tm6c2, d3tm6d2, d3tm6e2, d3tm6f2, d3tm6g2, d3tm6h2 automated match to d3tm6a_ complexed with peg, po4; mutant |
PDB Entry: 3tm6 (more details), 2.7 Å
SCOPe Domain Sequences for d3tm6e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tm6e1 b.1.1.2 (E:1-97) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvchsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdr
Timeline for d3tm6e1: