Lineage for d3tm6d_ (3tm6 D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1758823Protein beta2-microglobulin [88600] (5 species)
  7. 1758835Species Human (Homo sapiens) [TaxId:9606] [88602] (388 PDB entries)
    Uniprot P61769 21-119 ! Uniprot P01884
  8. 1759279Domain d3tm6d_: 3tm6 D: [200838]
    automated match to d3tm6a_
    complexed with peg, po4; mutant

Details for d3tm6d_

PDB Entry: 3tm6 (more details), 2.7 Å

PDB Description: Crystal structure of the beta-2 microglobulin DIMC50 disulphide-linked homodimer mutant
PDB Compounds: (D:) Beta-2-microglobulin

SCOPe Domain Sequences for d3tm6d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tm6d_ b.1.1.2 (D:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]}
miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvchsdlsfskd
wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrd

SCOPe Domain Coordinates for d3tm6d_:

Click to download the PDB-style file with coordinates for d3tm6d_.
(The format of our PDB-style files is described here.)

Timeline for d3tm6d_: