| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein beta2-microglobulin [88600] (7 species) |
| Species Human (Homo sapiens) [TaxId:9606] [88602] (480 PDB entries) Uniprot P61769 21-119 ! Uniprot P01884 |
| Domain d3tm6d1: 3tm6 D:1-98 [200838] Other proteins in same PDB: d3tm6a2, d3tm6b2, d3tm6c2, d3tm6d2, d3tm6e2, d3tm6f2, d3tm6g2, d3tm6h2 automated match to d3tm6a_ complexed with peg, po4; mutant |
PDB Entry: 3tm6 (more details), 2.7 Å
SCOPe Domain Sequences for d3tm6d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tm6d1 b.1.1.2 (D:1-98) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]}
iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvchsdlsfskdw
sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrd
Timeline for d3tm6d1: