SCOPe 2.03: Domain d3tlrd_: 3tlr D:

Lineage for d3tlrd_ (3tlr D:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88602] (342 PDB entries)
   Uniprot P61769 21-119 ! Uniprot P01884

8. Domain d3tlrd_: 3tlr D: [200835]
   automated match to d3tlrc_
   complexed with cd, na; mutant

Details for d3tlrd_

PDB Entry: 3tlr, 2.45 Å

PDB Description: Crystal Structure of the tetrameric Beta-2 microglobulin DIMC20 mutant

PDB Compounds: (D:) Beta-2-microglobulin

SCOPe Domain Sequences for d3tlrd_:

Sequence; same for both SEQRES and ATOM records:

>d3tlrd_ b.1.1.2 (D:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]}
miqrtpkiqvysrhpaengkcnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
wsfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm

Timeline for d3tlrd_:

• d3tlrd_ is new in SCOPe 2.03-stable
  
• d3tlrd_ appears in SCOPe 2.04
  
• d3tlrd_ appears in the current release, SCOPe 2.08, called d3tlrd1