SCOPe 2.06: Domain d3tloa_: 3tlo A:

Lineage for d3tloa_ (3tlo A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (6 species)
   contains an extra alpha-helical domain

7. Species Human coronavirus [TaxId:443239] [188597] (3 PDB entries)

8. Domain d3tloa_: 3tlo A: [200833]
   automated match to d3tlob_
   complexed with gol, peg

Details for d3tloa_

PDB Entry: 3tlo, 1.6 Å

PDB Description: Crystal structure of HCoV-NL63 3C-like protease

PDB Compounds: (A:) 3C-like proteinase

SCOPe Domain Sequences for d3tloa_:

Sequence; same for both SEQRES and ATOM records:

>d3tloa_ b.47.1.4 (A:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {Human coronavirus [TaxId: 443239]}
sglkkmaqpsgcvercvvrvcygstvlngvwlgdtvtcprhviapsttvlidydhaystm
rlhnfsvshngvflgvvgvtmhgsvlrikvsqsnvhtpkhvfktlkpgdsfnilacyegi
asgvfgvnlrtnftikgsfingacgspgynvrndgtvefcylhqielgsgahvgsdftgs
vygnfddqpslqvesanlmlsdnvvaflyaallngcrwwlcstrvnvdgfnewamangyt
svssvecysilaaktgvsveqllasiqhlhegfggknilgysslcdeftlaevvkqmygv
nl

Timeline for d3tloa_:

• d3tloa_ first appeared in SCOPe 2.03
  
• d3tloa_ appears in SCOPe 2.05
  
• d3tloa_ appears in SCOPe 2.07
  
• d3tloa_ appears in the current release, SCOPe 2.08