Lineage for d3tlfe_ (3tlf E:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2100042Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2100043Protein automated matches [190246] (54 species)
    not a true protein
  7. 2100309Species Mycobacterium avium [TaxId:1770] [189738] (3 PDB entries)
  8. 2100317Domain d3tlfe_: 3tlf E: [200832]
    automated match to d3tlfa_
    complexed with edo

Details for d3tlfe_

PDB Entry: 3tlf (more details), 2.15 Å

PDB Description: crystal structure of an enoyl-coa hydratase/isomerase from mycobacterium paratuberculosis
PDB Compounds: (E:) enoyl-CoA hydratase/isomerase

SCOPe Domain Sequences for d3tlfe_:

Sequence, based on SEQRES records: (download)

>d3tlfe_ c.14.1.0 (E:) automated matches {Mycobacterium avium [TaxId: 1770]}
sfdtikyevdghtatitlnrpdalnalsphmitelraayheaenddrvwllvvtgtgraf
csgadvkeipedgkviyerpylstydqweapqegtppfrtmakpvltavngiccgagmdw
vtttdiviaseqatffdphvsiglvagrelvrvsrvlprsialrmalmgkhermsaqray
elgliseivehdrlleraheiadivnsnaplavrgtrlailkglnvplheaeilaetfre
rvlrtedaaegprafvekrqpnwqcr

Sequence, based on observed residues (ATOM records): (download)

>d3tlfe_ c.14.1.0 (E:) automated matches {Mycobacterium avium [TaxId: 1770]}
sfdtikyevdghtatitlnrpdalnalsphmitelraayheaenddrvwllvvtgtgraf
csgadvrpylstydqweapqegtppfrtmakpvltavngiccgagmdwvtttdiviaseq
atffdphvsiglvagrelvrvsrvlprsialrmalmgkhermsaqrayelgliseivehd
rlleraheiadivnsnaplavrgtrlailkglnvplheaeilaetfrervlrtedaaegp
rafvekrqpnwqcr

SCOPe Domain Coordinates for d3tlfe_:

Click to download the PDB-style file with coordinates for d3tlfe_.
(The format of our PDB-style files is described here.)

Timeline for d3tlfe_: