SCOPe 2.04: Domain d3tiof_: 3tio F:

Lineage for d3tiof_ (3tio F:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.0: automated matches [191560] (1 protein)
   not a true family

6. Protein automated matches [190967] (25 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [193604] (2 PDB entries)

8. Domain d3tiof_: 3tio F: [200830]
   automated match to d3tioc_
   complexed with po4, zn

Details for d3tiof_

PDB Entry: 3tio, 1.41 Å

PDB Description: Crystal structures of yrdA from Escherichia coli, a homologous protein of gamma-class carbonic anhydrase, show possible allosteric conformations

PDB Compounds: (F:) Protein YrdA

SCOPe Domain Sequences for d3tiof_:

Sequence; same for both SEQRES and ATOM records:

>d3tiof_ b.81.1.0 (F:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
dvlhpyrdlfpqigqrvmiddssvvigdvrladdvgiwplvvirgdvhyvqigartniqd
gsmlhvthkssynpdgnpltigedvtvghkvmlhgctignrvlvgmgsilldgaiveddv
migagslvpqnkrlesgylylgspvkqirplsdeekaglrysannyvkwkdeyldqg

Timeline for d3tiof_:

• d3tiof_ first appeared in SCOPe 2.03
  
• d3tiof_ appears in SCOPe 2.05
  
• d3tiof_ appears in the current release, SCOPe 2.08