Lineage for d3th6a_ (3th6 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2078561Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2078562Family c.1.1.1: Triosephosphate isomerase (TIM) [51352] (2 protein domains)
    automatically mapped to Pfam PF00121
  6. 2078901Protein automated matches [196175] (7 species)
    not a true protein
  7. 2078910Species Rhipicephalus microplus [TaxId:6941] [196184] (1 PDB entry)
  8. 2078911Domain d3th6a_: 3th6 A: [200825]
    automated match to d3th6b_

Details for d3th6a_

PDB Entry: 3th6 (more details), 2.4 Å

PDB Description: Crystal structure of Triosephosphate isomerase from Rhipicephalus (Boophilus) microplus.
PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d3th6a_:

Sequence, based on SEQRES records: (download)

>d3th6a_ c.1.1.1 (A:) automated matches {Rhipicephalus microplus [TaxId: 6941]}
arrfcvggnwkmhgsknsirdicntlkgasldpnvevivacpapyldycrsllppsvala
aqncykveqgaftgeispgmikdcggqwvilghserrhvfkeddvligekikhalesgln
viacigelledreagrteevcfrqikhiasnvkdwskvviayepvwaigtgktatpdqaq
evhskvrnwlstnvsadvaskvriqyggsvnagnckelgrkpdidgflvggaslkpefvq
iinamqg

Sequence, based on observed residues (ATOM records): (download)

>d3th6a_ c.1.1.1 (A:) automated matches {Rhipicephalus microplus [TaxId: 6941]}
arrfcvggnwkmhgsknsirdicntlkgasldpnvevivacpapyldycrsllppsvala
aqncykveqgaftgeispgmikdcggqwvilghserrhvfkeddvligekikhalesgln
viacigelledreagrteevcfrqikhiasnvkdwskvviayepvwaigtatpdqaqevh
skvrnwlstnvsadvaskvriqyggsvnagnckelgrkpdidgflvggaslkpefvqiin
amqg

SCOPe Domain Coordinates for d3th6a_:

Click to download the PDB-style file with coordinates for d3th6a_.
(The format of our PDB-style files is described here.)

Timeline for d3th6a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3th6b_