SCOPe 2.08: Domain d3th4t2: 3th4 T:107-210

Lineage for d3th4t2 (3th4 T:107-210)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Extracellular region of human tissue factor [49267] (2 species)
   tandem of fibronectin type III domains

7. Species Human (Homo sapiens) [TaxId:9606] [49268] (35 PDB entries)
   Uniprot P13726 33-242

8. Domain d3th4t2: 3th4 T:107-210 [200824]
   Other proteins in same PDB: d3th4h_, d3th4l1, d3th4l2, d3th4l3
   automated match to d1uj3c2
   complexed with 0ge, bgc, ca, cl, fuc, mg, na

Details for d3th4t2

PDB Entry: 3th4, 1.8 Å

PDB Description: mg2+ is required for optimal folding of the gamma-carboxyglutamic acid (gla) domains of vitamin k-dependent clotting factors at physiological ca2+

PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d3th4t2:

Sequence, based on SEQRES records:

>d3th4t2 b.1.2.1 (T:107-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk
taktntneflidvdkgenycfsvqavipsrtvnrkstdspvecm

Sequence, based on observed residues (ATOM records):

>d3th4t2 b.1.2.1 (T:107-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywktaktntn
eflidvdkgenycfsvqavipsrtvnrkstdspvecm

Timeline for d3th4t2:

• d3th4t2 first appeared in SCOPe 2.03
  
• d3th4t2 appears in SCOPe 2.07