Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Extracellular region of human tissue factor [49267] (2 species) tandem of fibronectin type III domains |
Species Human (Homo sapiens) [TaxId:9606] [49268] (34 PDB entries) Uniprot P13726 33-242 |
Domain d3th3t1: 3th3 T:6-106 [200821] Other proteins in same PDB: d3th3h_, d3th3l1, d3th3l2 automated match to d1uj3c1 complexed with 0ge, bgc, ca, cl, fuc |
PDB Entry: 3th3 (more details), 2.7 Å
SCOPe Domain Sequences for d3th3t1:
Sequence, based on SEQRES records: (download)
>d3th3t1 b.1.2.1 (T:6-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk dvkqtylarvfsypagnvestgsageplyenspeftpylet
>d3th3t1 b.1.2.1 (T:6-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk dvkqtylarvfsypagngeplyenspeftpylet
Timeline for d3th3t1: