Lineage for d3th2t2 (3th2 T:107-210)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2035676Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2035677Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2035780Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 2035781Species Human (Homo sapiens) [TaxId:9606] [49268] (34 PDB entries)
    Uniprot P13726 33-242
  8. 2035794Domain d3th2t2: 3th2 T:107-210 [200820]
    Other proteins in same PDB: d3th2h_, d3th2l1, d3th2l2, d3th2l3
    automated match to d1uj3c2
    complexed with ben, bgc, ca, cl, fuc, mg, na

Details for d3th2t2

PDB Entry: 3th2 (more details), 1.72 Å

PDB Description: mg2+ is required for optimal folding of the gamma-carboxyglutamic acid (gla) domains of vitamin k-dependent clotting factors at physiological ca2+
PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d3th2t2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3th2t2 b.1.2.1 (T:107-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk
taktntneflidvdkgenycfsvqavipsrtvnrkstdspvecm

SCOPe Domain Coordinates for d3th2t2:

Click to download the PDB-style file with coordinates for d3th2t2.
(The format of our PDB-style files is described here.)

Timeline for d3th2t2: