Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) |
Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
Protein Extracellular region of human tissue factor [49267] (2 species) tandem of fibronectin type III domains |
Species Human (Homo sapiens) [TaxId:9606] [49268] (32 PDB entries) Uniprot P13726 33-242 |
Domain d3th2t2: 3th2 T:107-210 [200820] Other proteins in same PDB: d3th2h_, d3th2l1, d3th2l2, d3th2l3 automated match to d1uj3c2 complexed with ben, bgc, ca, cl, fuc, mg, na |
PDB Entry: 3th2 (more details), 1.72 Å
SCOPe Domain Sequences for d3th2t2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3th2t2 b.1.2.1 (T:107-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk taktntneflidvdkgenycfsvqavipsrtvnrkstdspvecm
Timeline for d3th2t2:
View in 3D Domains from other chains: (mouse over for more information) d3th2h_, d3th2l1, d3th2l2, d3th2l3 |