SCOP 1.69: Domain d1gafl1: 1gaf L:1-109

Lineage for d1gafl1 (1gaf L:1-109)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (162 PDB entries)

8. Domain d1gafl1: 1gaf L:1-109 [20082]
   Other proteins in same PDB: d1gafh1, d1gafh2, d1gafl2
   part of humanized Fab 48G7

Details for d1gafl1

PDB Entry: 1gaf, 1.95 Å

PDB Description: 48g7 hybridoma line fab complexed with hapten 5-(para-nitrophenyl phosphonate)-pentanoic acid

SCOP Domain Sequences for d1gafl1:

Sequence; same for both SEQRES and ATOM records:

>d1gafl1 b.1.1.1 (L:1-109) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
diqmtqspsslsaslgervsltcrasqeingylgwlqqkpdgtikrliyaastlhsgvpk
rfsgsrsgsdysltisslesedfadyyclqyasyprtfgggtkveikrt

Timeline for d1gafl1:

• d1gafl1 first appeared (with stable ids) in SCOP 1.55
  
• d1gafl1 appears in SCOP 1.67
  
• d1gafl1 appears in SCOP 1.71
  
• d1gafl1 appears in the current release, SCOPe 2.08