| Class b: All beta proteins [48724] (93 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
| Species Fab 48G7 (mouse/human), kappa L chain [48810] (4 PDB entries) |
| Domain d1gafl1: 1gaf L:1-109 [20082] Other proteins in same PDB: d1gafh2, d1gafl2 |
PDB Entry: 1gaf (more details), 1.95 Å
SCOP Domain Sequences for d1gafl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gafl1 b.1.1.1 (L:1-109) Immunoglobulin (variable domains of L and H chains) {Fab 48G7 (mouse/human), kappa L chain}
diqmtqspsslsaslgervsltcrasqeingylgwlqqkpdgtikrliyaastlhsgvpk
rfsgsrsgsdysltisslesedfadyyclqyasyprtfgggtkveikrt
Timeline for d1gafl1: